Companies similar to USABLE CORPORATION
Sign up to Download

1-30 of 7,116,140 results

  • www.arkansasbluecross.com
  • 27
  • 56
  • 59
Arkansas Blue Cross differs from commercial insurers in several ways. Arkansas Blue Cross is a not-for-profit mutual insurance company. That means that nearly all the money we collect as premium is paid out in benefits for customers - on the average,..
Relevance: 22.23221
  • www.healthadvantage-hmo.com
  • 6
  • 15
  • 5
Health Advantage is Arkansas' largest and oldest health maintenance organization, providing flexible and affordable group health plans to small and large employers. Our vast network of quality and value-focused healthcare providers will ensure..
Relevance: 21.3454
  • www.blueadvantagearkansas.com
  • 22
BlueAdvantage Administrators of Arkansas is Arkansas' largest third-party administrator, administering employer health-plan benefits for more than 1 million members. As an operating division of Arkansas Blue Cross and Blue Shield, BlueAdvantage..
Relevance: 19.402485
  • blueribbonoutdoor.com
  • 1
  • 1
At Blue Ribbon Outdoor we pride ourselves on being able to offer timeless, unique and gorgeous outdoor environments to the residents and businesses we serve. Your property should reflect all the beauty and taste that guides your life. Start living..
Relevance: 18.63663
  • www.redandbluearkansas.com
  • 1
  • 2
Red & Blue was founded by Stephanie and Roby Brock to provide a place for unique special events in central Arkansas. After hearing from friends and family about the need for a venue that could accommodate a variety of corporate and personal..
Relevance: 18.463923
  • www.candcpackinginc.com
  • 1
  • 2
C & C Packing Company is located on the west side of Stamps, Arkansas, along U.S. Highway 82. We have provided a map with a blue pin to mark our location to the left... C and C Packing Company, located in Stamps, Arkansas providing only the best..
Relevance: 18.255802
  • bluecrane.us
  • 1
  • 24
Blue Crane is a real estate development company creating places for humanity to flourish in Northwest Arkansas. Located in Bentonville, the Mountain Biking Capital of the World, Blue Crane produces catalytic projects that connect communities to..
Relevance: 18.058273
  • pinben.tripod.com
  • 1
  • 1
  • 3
Kristi Stocker opened Southeast Insurance in March 1994. From the beginning, Southeast has specialized in employee benefits. Through the years, Southeast has received special recognition from such distinguished companies as Arkansas Blue Cross and..
Relevance: 17.758894
  • www.bluespringheritage.com
  • 1
  • 1
The Blue Spring Heritage Center is a botanical garden offering weddings and featuring American Indian history and traditions in Eureka Springs, Arkansas... Blue Spring offers wonderful settings for picturesque, romantic ceremonies. The sites range..
Relevance: 17.347004
  • greenleafgrill.com
  • 1
  • 1
  • 2
Arkansas Blue Cross and Blue Shield opened Green Leaf Grill in 2013 as a way to lead the charge to healthier living. The restaurant aims to change the culture of dining out from within. Starting with our own company, we want people to know there's a..
Relevance: 16.874287
  • healthbenefitinsight.com
We're an Arkansas company with offices throughout the state. Our deep local roots means we know the state and the healthcare challenges it faces; have relationships with its providers; and a serious interest in keeping it healthy... You want your..
Relevance: 16.680094
  • bluehilltowing.com
  • 1
  • 2
Stranded with a broken-down vehicle? Blue Hill Towing & Recovery offers prompt and efficient emergency towing services for all your light-duty towing needs. Our commitment is to get you back on the road as quickly and safely as possible, regardless..
Relevance: 16.197945
  • www.arkansasbluecross.com
  • 27
  • 49
  • 57
As a not-for-profit, mutual insurance company, Arkansas Blue Cross is owned by its policyholders, not by stockholders. This means that premium dollars are used solely to pay claims and administrative costs, not to pay stock dividends. Any excess..
Relevance: 16.06771
  • firesafechimneyserviceandrepair.com
  • 1
  • 1
Fire Safe Chimney Service and Repair's owner/operator Kevin O'Kelley is one of Blue Eye's most experienced chimney and fireplace professionals. Whether you need a sweep, repair, inspection, install, refurbishment/restoration, Kevin offers top-quality..
Relevance: 16.048044
  • www.cophers.com
  • 3
  • 2
Located in Fort Smith, we have a customer base that includes surrounding cities in Arkansas and Oklahoma including, Van Buren, Sallisaw, Greenwood, Barling, Alma, Poteau, Tulsa, Little Rock, Fayetteville, Rogers, Springdale, Hot Springs, Mena, and..
Relevance: 15.98613
  • www.advancedsealingandstriping.com
  • 1
  • 1
Advanced Sealing & Striping began as a three-person crew in 2004 with Brian Box, his wife Melissa, and their son, Tyler. Since then we have perfected our skills, and in 2008 Advanced Sealing & Striping became our full-time business. From that very..
Relevance: 15.937331
  • www.keenerdentistry.com
  • 1
  • 2
Keener Dentistry has been taking care of families in Harrison, Arkansas since 1949. We believe in educating patients on their individual treatment options and helping them make informed decisions. We feel lifelong relationships are based on trust,..
Relevance: 15.395911
  • www.3oaksresort.com
  • 1
  • 1
Lawellin's Three Oaks Resort sits on the shores of Lake Norfork giving you an extraordinary panoramic view of its clear blue waters, majestic hillsides, and beautiful Arkansas sunsets. The unique cottages are made of native Arkansas stone and have a..
Relevance: 15.324116
  • www.bvia.com
  • 16
  • 3
  • 16
Blue Valley Insurance Agency is committed to making it easier for you to buy and own insurance. Our agents are dedicated to providing our customers with the best service and competitive rates for their auto, home, and commercial insurance needs in..
Relevance: 15.04992
  • arkansaswebdesigndirectory.com
CBDSEO.io is a leading digital marketing company for cannabidiol (CBD) based products businesses. We specialize in providing high-quality search visibility..... Neutral Blue is a web design agency located in Little Rock, Arkansas. Over the years we..
Relevance: 14.811062
  • www.eagleheadoutdoors.com
  • 1
  • 1
Let our years of success do the work for you, while you enjoy a memorable hunt. Although there are blue bird days, our clients are never disappointed. With our monster decoy spreads, multiple e-callers and veteran guides, our success ratio is among..
Relevance: 14.750143
  • www.bluemountainwoodwork.com
  • 1
  • 1
Blue Mountain Woodworks is a father-son partnership. We build our custom-made furniture, cabinets and other products using native Arkansan hardwoods from the Ozarks. We have Walnut, Cherry, Red Oak, White Oak, HIckory, Ash, Maple and Aromatic Cedar..
Relevance: 14.635386
  • www.fluid-disposal.com
  • 1
If you're looking for quality and customer service, you've come to the right place. We are a Louisiana based company with more than 35 years of experience and with more than 200 employees that specialize in oil and gas site preparation, road..
Relevance: 14.112509
  • morganpeck.com
  • 1
My name is Morgan Peck and I am a front-end web developer for Arkansas Blue Cross Blue Shield. I currently live in Lawerence Kansas with my husband, daughter and two cats. I love to build front end experiences for users trying to focus on making..
Relevance: 14.111712
  • arwtc.org
  • 7
  • 7
Arkansas offers the world exceptional opportunities and the World Trade Center Arkansas is dedicated to growing bilateral trade for the state by delivering world class services, global connections and export development programs to Arkansas..
Relevance: 14.111375
  • uca.edu
  • 108
  • 268
  • 350
The University of Central Arkansas Police Department is an effective, skilled, and progressive organization made up of men and women who are dedicated to their profession and to the mission and values of the University. We are dedicated and committed..
Relevance: 14.098759
  • www.stonemeadowresort.com
  • 1
  • 2
Stone Meadow Resort is situated on a beautiful 14 acre meadow near Eureka Springs, Arkansas with easy highway access. Only 10 scenic miles from Downtown Eureka Springs, our property offers a walking trail, outdoor chess and checkers and hours of bird..
Relevance: 14.055743
  • brandcatalystco.com
  • 3
  • 1
Since 2016, we've helped businesses and organizations throughout Arkansas to establish their brands and achieve measured results. While we've worked in a variety of industries and on a myriad of projects, the overwhelming pull to serve outdoor..
Relevance: 13.99892
  • www.usablemco.com
  • 1
  • 1
USAble MCO, a wholly owned subsidiary of Arkansas Blue Cross Blue Shield, is approved to operate through certification by the Arkansas Workers' Compensation Commission (AWCC). According to the AWCC Rule 33, contracting with a managed care..
Relevance: 13.952403
  • www.bigweldllc.com
  • 1
We can handle anything from engineered blue prints to a hair brained idea on a cocktail napkin. We can make the vision in your head come to life... BIGWELD has 20 years of experience in Custom Metal Fabrication, Welding, and Design. In addition to..
Relevance: 13.942673