Companies similar to NEED CDI
Sign up to Download

121-150 of 6,744,735 results

  • innova-es.com
  • 1
  • 2
Innova Energy Services was born in 2004 in Houston, TX, the Energy Capital of the world. We provide Pipe Repair, Pipeline Services, Power & Utility Services, and Technical Inspection & Testing services to Pipe Mills, Trading Companies, Master..
Relevance: 3.0992315
  • www.expanding-services.com
  • 2
  • 1
  • 1
Expanding Services is set up in early 2009, aim to provide I.T & web services to help companies expand their capacity and to grow their business. The company aim of providing top I.T services is the factor which drives us to constantly upgrade..
Relevance: 3.0987935
  • tetraproton.com
  • 1
Tetra Proton is a provider of professional power services throughout the country, from design to implementation and maintenance services. Our... Tetra Proton provides best-cost solutions and services to the communications industry. Below are major..
Relevance: 3.0987759
  • www.sudharsanamcranes.com
  • 2
Sudharsanam are one stop solution for all crane rental services in Chennai. We offer the ease for connecting with the client anywhere and anytime. We offer the broad marketplace where you can get the broad range of products. We suggest enhanced..
Relevance: 3.0977864
  • www.impressoservices.com
  • 1
  • 1
IMPRESSO SERVICES, An ISO 9001:2015 certified firm established in December, 2016 is recognised in the market for its ability to provide Facility Management Services, Human Resource Management Services, Manpower Outsourcing, IT-Solution, Security &..
Relevance: 3.0972142
  • www.hthcexp.com
  • 1
  • 1
HTHC Express services offers services to a wide range of customer, each with there specific needs. HTHC Express services offers services to a wide range of customer, each with there specific needs. HTHC Express services is one of the world's leading..
Relevance: 3.0971546
  • www.dandcbackhoeservices.com
  • 1
  • 1
D&C Backhoe Services, LLC is a licensed and insured company that offers 24 hour Hot Shot services, road crossing rental, road crossing installation, lay flat hose delivery, roll out or roll up services, in addition to backhoe and heavy equipment..
Relevance: 3.0965137
  • www.perfounder.com
  • 1
  • 1
Beijing Perfounder Consulting Co., Ltd. over the past decade has focused on Science and Technology advisory services, Investment and Financing consulting services and Public Relations consulting services... We specialize in technology consulting to..
Relevance: 3.0963047
  • www.laredoautopart.com
  • 1
  • 1
Since 2009, J &L Auto Repair shop has provide motorists in Everett WA 98203 area with comprehensive auto repair services that include General Services, Car & Truck Care, Undercar Services. Engine & Transmission, Engine Maintenace, Transmission..
Relevance: 3.0958705
  • www.affordableri.com
  • 1
  • 1
Affordable Auto Body is a full-service auto body repair facility in the Warwick, RI 02888 area, specializing in Auto Body & Refinishing Services , Collision Repair Services, Quick Lube Services, General Services, and Car & Truck Care since 1985.....
Relevance: 3.0958643
  • www.monarchsoftel.com
Catering to the requirements offices, industries, educational institutes such as universities, colleges, etc., we, MSTIPL, bring forth a host of IT Services. Right from Computer AMC Services, Data Processing Services, Data Recovery Services, Domain..
Relevance: 3.0951793
  • www.saf.com.pk
  • 1
  • 4
Speedy Active Freight is amongst the renowned global cargo service providers headquarter at Sialkot, Pakistan. We are serving our valuable clients since 1991. We offer a broad portfolio of services including Air Freight Services, Railway..
Relevance: 3.0951056
  • topmanpowers.com
  • 4
  • 2
Top man power management services provide the security services & human resources in all over the India. Currently we have 300+ clients to whom we are dealing with. There is 30+ field officers are working in pan India with 3000+ employees from Top..
Relevance: 3.0950332
  • www.gads-inc.com
  • 6
Generations Adult Day Services, Inc. is a Georgia Medicaid Waiver Healthcare Provider contracted through the Department of Behavioral Health and Developmental Disabilities (DBHDD) and licensed through Healthcare Facility Regulations. The company has..
Relevance: 3.0945575
  • stratcpartners.com
  • 1
Strategic Contracting Partners (SCP) is a Minority Owned professional services firm located in Randallstown, MD. Our organization was founded on the principles of providing Federal and Commercial Financial Management Services and Contract Management..
Relevance: 3.0938408
  • ratnaprakashfacilityservices.com
  • 3
  • 2
Ratna Prakash Facility Services is one of the Reputed Facility Services Firm in Mumbai. We are the active suppliers of Corporate Facility in Mumbai since the year 2020. Our firm offers the supreme housekeeping and sanitation services to prime hotels,..
Relevance: 3.0927567
  • www.zebrac.com
  • 3
  • 3
ZEBRA Consultants is a Business Information Technology company in Cyprus providing IT solutions and services. The services we provide are IT consulting services, software development, specialized applications, portals, websites and mobile..
Relevance: 3.092723
  • brotherssonscontractorllc.construction
  • 1
  • 1
Brothers & Sons Contractor LLC is a General Contractor, Deck Builder & Home Builder located in Richmond, VA and has been servicing all of Richmond and the surrounding areas for many years. We specialize in Construction Services, House Remodeling,..
Relevance: 3.0927093
  • www.nncleaningcompany.com
  • 2
  • 1
N & N Cleaning Services is a reliable and trustworthy cleaning and housekeeping company providing the best quality in cleaning services to Connecticut's New Haven & Fairfield Counties... N & N Cleaning Services is experienced in offering the best..
Relevance: 3.0923069
  • ccotexsvc.com
  • 1
  • 1
Career Consultants of Texas Services is a specialized career services firm. We provide comprehensive career services for our clients that are customized to fit their individual needs. We provide full life cycle career services from contract, contract..
Relevance: 3.0923026
  • bishtcraneservice.com
  • 2
  • 2
Bisht Crane Service is establishes the best Service provider of Forklift On Hire, 24 Hours Cranes On Hire, Crane Hydraulic Escorts Services, Crane Crompton Graves Services, Hydra Crane Services, Crane Hydraulic Ace Services, Towing Crane Rental..
Relevance: 3.0920575
  • www.waniyauae.com
  • 3
  • 5
  • 5
The Waniya Group is a leading provider of security services in UAE with diverse solutions across the security spectrum... Dar Alward General Trading We are offering one-stop solutions to clients across the globe. Get The Services Facility Management..
Relevance: 3.09192
  • www.riversidepsychological.com
  • 1
  • 2
  • 1
Welcome to Riverside Psychological Services, LLC! Riverside has been providing competent psychological services to Southeast Minnesota residents since 1987. We are committed to providing effective and professional services to adults, adolescents,..
Relevance: 3.0918717
  • www.scmservices.net
  • 1
  • 3
SCM Services are supply chain management professionals supporting creditable services meeting the needs of businesses throughout the world. Our experience working with both small and large organisations has developed our services in assessing and..
Relevance: 3.0917242
  • alliancefieldservices.com
  • 1
Alliance Field Services is a highly-regarded provider of oilfield services to the oil and gas industry within the Permian Basin, which presently consists of the largest volume onshore oil and gas drilling rigs in the U.S. The Company's wide-range of..
Relevance: 3.0909417
  • ecegroup.co.uk
  • 1
  • 1
ECE Group Services are an established provider of specialist fire safety services and facility support services to commercial and industrial clients throughout the UK... ECE Group Services Ltd is dedicated to ensuring that the highest practicable..
Relevance: 3.0907423
  • www.prattvillerv.com
  • 1
Since 1999, Prattville Auto & RV Repair Center LLC has provided motorists in the Prattville, AL 36067 area with comprehensive auto and RV repair services that include RV Repair Services, AC Repair, Brakes, Car & Truck Care, Collision Repair Services,..
Relevance: 3.0907423
  • www.htc.ly
  • 3
  • 3
Our goal is to provide fully managed IP services to our customers and the most robust, reliable and fully comprehensive managed Internet backbone service at the same time. These services and their value far exceed that of our competitors... We..
Relevance: 3.0907097
  • www.myworldpanel.com
Kantar is providing you access to its software, software as a service, or services (collectively, the "Services") subject to the terms of an executed Master Services Agreement or License Agreement between KANTAR and you or your Company (the..
Relevance: 3.090256
  • fascellafinishes.com
  • 1
  • 1
Fascella Finishes Inc is one of the most successful and largest commercial and residential painting company in the Orange County area. We provide quite a few services including: Painting Services, Dry Walling Services, Plastering Services. Our..
Relevance: 3.0902288