Companies similar to SFS
Sign up to Download

1-30 of 6,209,780 results

  • strengthfacilityservices.com
  • 3
  • 6
  • 5
SFS is one of the trusted and highly admired housekeeping agencies in Mumbai which is known for quality Home Cleaning Services Mumbai at the best price... Best Housekeeping services in Mumbai | Top Housekeeping Companies If we go by the definition..
Relevance: 30.05666
  • www.globalmanagementservices.in
  • 2
  • 2
Global Management Services is a leading and dynamic business consulting firm headquartered in the bustling city of Mumbai. With a rich history and a solid reputation, the company has been instrumental in transforming businesses across various..
Relevance: 26.646738
  • dhruvhousekeeping.com
  • 1
  • 4
  • 2
We provide Professional Housekeeping & Cleaning Services in Mumbai, Navi Mumbai, Panvel, Thane, Kalyan Dombivali, Mira Bhaindar, Vasai Virar, etc and in nearby areas. With more than 10 year's of experience in Housekeeping & Cleaning Services we are..
Relevance: 25.975416
  • www.homecleaning.co.in
  • 2
  • 2
We give you an on-demand and customizable service. We are a professional and reliable service provider and aim at 100% customer satisfaction... Tulip Home Cleaning Services is one of the leading Home cleaning services in Mumbai, Navi Mumbai, and..
Relevance: 25.485224
  • www.vishalmanagementservices.com
  • 1
  • 6
Vishal Management Services is a well-known facility management company in Mumbai. We provide supreme housekeeping and office cleaning services to major hotels, residential societies, commercial complexes, etc. Please contact us if you need facility..
Relevance: 24.053478
  • www.decofurngroup.com
  • 1
  • 1
DMMPL is a name synonymous with service excellence in delivering cutting edge and efficient housekeeping services along with the most efficient integrated facility management services. When it comes to providing integrated facility management..
Relevance: 23.53381
  • www.housekeepingservicesmumbai.com
  • 2
  • 1
A clean, fresh and hygiene appearance makes a company more attractive. Whether you run a small business or a large business, choosing the right corporate housekeeping cleaning services provider is truly essential. Swamy Facility Management is one of..
Relevance: 23.21784
  • deepcleanmumbai.com
  • 1
  • 2
  • 1
Infinite Xtensions is a professionally operated company, provides multiple services, including deep cleaning service in Mumbai, Thane, Navi-Mumbai & deep cleaning services in Pune. In addition, we do provide professional corporate housekeeping..
Relevance: 22.874622
  • www.splendourservices.com
  • 2
  • 1
Over the decade there has been a silent revolution in housekeeping, Cleaning procedures with latest technology and systems making an overall impact in such a scenario, therefore it is natural that today's customers are demanding the best in service..
Relevance: 22.833124
  • www.cleancareservices.net
  • 9
  • 9
CLEAN CARE SERVICES is a leading provider of diversified housekeeping services in cities like Chennai, Bangalore, Mumbai, Cochin, Hyderabad, Vijayawada, Pondicherry, Coimbatoreand and Trichy. Clean care services offers housekeeping services tailor..
Relevance: 22.248148
  • www.24x7maid.com
  • 1
  • 2
24x7 Maid is specialized in providing domestic cook services to the customer. We provide well trained, experienced domestic cooks who can cook tasty food of all the type like veg-non-veg food ect... Our firm is engaged in providing lavish..
Relevance: 22.182575
  • www.trigonservices.co.in
  • 1
We provide Security and Housekeeping Services in various parts of mumbai such as security services in vasai, bhayander, bandra, mira road, borivali, dadar,virar, nallasopara..
Relevance: 22.074446
  • www.sm-maidservices.com
  • 1
  • 2
We have involvement with giving proficient Maid Services, Housekeeping and Cook administrations across Mumbai, India. We are one of the quickest developing Companies as office the board administrations are concerned. We at SM Maid Services offer a..
Relevance: 20.465803
  • www.kkmanpower.com
  • 1
  • 1
KK Manpower is one of the renowned Maid Agency. Located in Mumbai, we provide skilled and verified maids, nurses, baby care takers, patient care, domestic helpers, cook, driver, old age care taker, new born care taker etc... KK Manpower is a..
Relevance: 20.378801
  • www.corpx.in
  • 2
  • 2
CORPX is the prominent brand in the field of corporate facility services. Moreover, CORPX is a Pune based company that gives multiple services to multiple organizations in all the areas near Pune and Mumbai. Therefore, all the organizations located..
Relevance: 20.344278
  • www.alliancebuildcare.com
  • 1
  • 1
Building wraps provide a medium that is unmissable, making this type of outdoor advertising very powerful in terms of promoting brand awareness. We are offering the best quality range of 3D Building Wraps to our customers and assists them in helping..
Relevance: 20.197231
  • www.reetufacility.com
  • 2
  • 1
Reetu facility services pvt.ltd.This brings to your kind attention that, we are one of the in cleaning servicessince 2002,all these 15-year the professional housekeeping organization has seen exponential growth in both quality & quantity having with..
Relevance: 19.96269
  • www.kkmaidservice.com
  • 1
  • 1
Hire a Maid in Mumbai with in a click. KK Maid Agency is the best solution for your requirements like: House Cleaner, Baby Care, Patient Care, Maid Service... We "KK MAID SERVICE" established in the 2015 at Mumbai. KK Maid Service founded by Mr...
Relevance: 19.687613
  • www.gharfix.com
  • 1
  • 1
GharFix can help you get rid of your leaking tap and bathroom repairs and all other related plumbing works , with reasonable pricing and trained plumbers.Our team is always available to serve you in all the areas of Mumbai and Navi Mumbai do not..
Relevance: 19.548424
  • techcleanindia.com
  • 1
  • 1
Techclean India Pvt Ltd is a leading professional housekeeping services provider based in Mumbai, India... Our vast experience and expertise prevent costly mistakes. For example, in the process of cleaning, many inadvertently actually damage the..
Relevance: 19.434654
  • www.northwestservisol.com
  • 1
  • 1
Northwest Integrated Facility Management Solutions (NIFMS) is an end to end facility management services provider in Pune, Mumbai and various other cities of Maharashtra & Gujrat. At NIFMS, we continually strive to improve in each of these domains to..
Relevance: 19.104654
  • www.otetservices.com
  • 1
  • 2
OTET Services is Mumbai based House Keeping, office cleaning and commercial cleaning company that do a quality job that won't disappoint. OTET Services is prominent name in the housekeeping Industry which has distinguished itself with the ability to..
Relevance: 19.084984
  • www.reliablehousekeepingservices.com
  • 1
  • 1
Reliable Housekeeping Services is one of the most reputed names in this domain as we have unmatched experience in this sector. We have emerged as the undisputed leader in housekeeping services. We are the first choice of companies looking for..
Relevance: 19.04494
  • www.housemaids.in
  • 1
  • 2
  • 1
At Housemaids.in, we are a young and dynamic team whose goal is to disrupt the Housekeeping service industry by solving people's problems while staying at home and away from home... The services offered by Housemaids.in revolve around the home maid..
Relevance: 19.019442
  • deepcleanpune.com
  • 2
  • 2
Moreover, we are a Pune-based cleaning company specializing in a range of services including Home Cleaning, Office Cleaning, Facade Cleaning, Carpet Cleaning, and Industrial Cleaning. Our service coverage extends to Pune, PCMC, Mumbai, Thane, and all..
Relevance: 18.908352
  • www.rayshousekeeping.com
  • 2
  • 1
We provide consultancy service and our all services are best in field of Employment Agency for Middle and Top management recruitment... We Rays Housekeeping Services, situated at LDA Colony, are one of the fastest-growing housekeeping service..
Relevance: 18.638155
  • yaaservices.com
  • 1
  • 1
YAA Infrastructure Management Services, a leading provider of professional housekeeping services in Kerala,is well known for leading the way and creating best practices in the area of facilities maintenance and management services... YAA..
Relevance: 18.363228
  • www.sangi.co.in
  • 1
We provide domestic help and health care services in all Mumbai, Navi Mumbai and Thane. We offers Maid, Cook, Baby Sitters, Male and Female Nurses, Ayahs, Newborn, Pregnancy care, Senior Citizen care, Attendants etc. Mr Kailas Barve is the Founder &..
Relevance: 18.291758
  • ratnaprakashfacilityservices.com
  • 1
  • 1
Ratna Prakash Facility Services is one of the Reputed Facility Services in Mumbai. We are the active suppliers of Corporate Facility Services In Mumbai since the year 2020. Our firm offers the supreme housekeeping and sanitation services to prime..
Relevance: 18.220608
  • www.worldcaretakerfacilityservices.com
  • 1
  • 1
We World care taker facility services help our customers to source and hire the most eligible help in their town and select the highly skilled, experienced professionals to fix their household tasks. Our assisted professional services are..
Relevance: 18.122507