Companies similar to A2Z
Sign up to Download

121-150 of 7,006,246 results

  • www.vinayvaletparking.com
  • 1
  • 2
Vinay Valet Parking is the leading and largest valet parking company in Delhi. The Company has been providing the services for nearly two decades... At 22 years of professional Vinay Valet parking services, we offer convenient and secure Valet..
Relevance: 3.7114074
  • dislaman.com
We provide logistic services in the nation, whether it is freight transportation, supply chain solutions, warehousing and distribution, customer resource area services, customs, security and insurance, temperature controlled logistics, industry ….....
Relevance: 3.709432
  • www.dhxcourier.us
  • 1
  • 1
We understand the importance of time, which is why our courier services are designed to meet your bespoke needs... We take pride in being regarded as one of the most reliable and affordable logistic and warehousing service providers in the country...
Relevance: 3.7093513
  • www.dandcbackhoeservices.com
  • 1
  • 1
D&C Backhoe Services, LLC is a licensed and insured company that offers 24 hour Hot Shot services, road crossing rental, road crossing installation, lay flat hose delivery, roll out or roll up services, in addition to backhoe and heavy equipment..
Relevance: 3.7091587
  • www.nishtharealestate.com
  • 1
  • 2
Nishtha Real Estate is a renowned name in the domain of real estate and is reckoned for providing complete assistance related to residential, commercial, industrial and agricultural properties. The company came into existence in the year 2003 and is..
Relevance: 3.708332
  • eastwickfamily.com
  • 2
Eastwick Family Service is a registered Social Services provider in the State of Pennsylvania. We provide services for individuals with various disabilities. Our Dynamic staffs are here to accommodate you and make the referral process as simple as..
Relevance: 3.7077112
  • brioservices.net
  • 1
  • 1
BRIO is an integrated manpower and facilities solutions company, providing you with security personnel, facility management staff, janitorial services.... BRIO is one of the pioneers in Facility services and Guarding services since 1979. Now under..
Relevance: 3.7075727
  • thincsoft.com
  • 2
  • 1
ThincSofts main business pillars are IT Services and Engineering services. IT Services arm of the company creates IT solutions for our clients in Application, Testing and Validations, Maintenance, Infrastructure, Enterprise and Management..
Relevance: 3.706572
  • www.eurolineinternational.net
  • 2
  • 1
Established in 1993, Euroline International Ltd is a leading international integrated business service provider in Turkey. We specialize in international business promotion services, marketing strategies, representation and consulting services. At..
Relevance: 3.7064433
  • www.ivyservices.com
  • 2
At Ivy Services Ltd we offer the following services... Since its foundation, Ivy Services Ltd has successfully completed hundreds of projects, both large and small. As one can see in the "checkatrade" website, it is one of the most popular companies..
Relevance: 3.705946
  • www.greateretowah.com
  • 3
  • 2
  • 3
Based in Gadsden, Alabama, the Greater Etowah 310 Board offers a wide variety of services to individuals with intellectual disabilities. At the present time, services provided consist of Facility Day Habilitation, Community Day Habilitation,..
Relevance: 3.7057772
  • www.uniqueservice.co.in
  • 1
  • 2
We offer international courier services in Mumbai at cheapest rate. Send your courier / parcel abroad - anywhere in the world easily and quickly with the help of Unique Services. Call now!... We at "UNIQUE SERVICES" bring with us 15 years of..
Relevance: 3.705275
  • www.hcsoffshore.com
  • 1
  • 2
Hermes Corporate Services ("HCS") is a leading offshore provider of formation services, registered office services, corporate services, compliance solutions services and other services in the British Virgin Islands (BVI) which is regulated by the..
Relevance: 3.7048593
  • www.grandtech.in
  • 5
  • 7
Grandtech is one of the leading institutions of All kinds of Web and digital services .As a market player with name and fame now we are going to enter in diversifies services.Keeping in mind the gap between service and demand in Urban and rural areas..
Relevance: 3.7048044
  • www.satyampackersindia.com
  • 4
  • 2
Satyam Packers and Movers in Bareilly is one of the awesome service providers of Car Transportation Services, Home Relocation Services, Packing and Moving Services, Transportation Services, Loading and unloading Services, Door to Door Delivery..
Relevance: 3.704002
  • www.lifechangerhealthservices.com
  • 1
  • 1
Life Changer Health Services (LCHS) is registered in Maryland and licensed by the Department of Home Health quality as a Residential Services Agency. Our Registration number is R4911. LCHS is incorporated as a Limited Liability Company (LLC). Life..
Relevance: 3.7035303
  • www.familypreservationla.com
  • 1
  • 3
Family Preservation Services is a subsidiary of Pathways and specializes in non-residential, community-based services for adults with severe emotional/ behavioral disorders who are also receiving Medicaid. The goal of FPS is to provide "Human..
Relevance: 3.7030334
  • www.offshoremanagers.com
  • 1
  • 2
  • 1
OFFSHORE MANAGERS LIMITED (OML) is an Independent Financial Services Company organized and incorporated in the Commonwealth of the Bahamas on April 17, 1990. The company is licensed and regulated under the provisions of the Financial and Corporate..
Relevance: 3.7027571
  • www.ssberjaya.com
  • 9
  • 2
  • 6
We provide logistic services in the nation, whether it is freight transportation, supply chain solutions, warehousing and distribution, customer resource area services, customs, security and insurance, temperature controlled logistics, industry ….....
Relevance: 3.702606
  • www.classicindustrial.com
  • 9
  • 8
Since 1988, Classic Industrial Services has been a leading provider of specialty contracting services in the industrial market throughout the United States. We pride ourselves on innovation and effectiveness in a variety of application areas. Our..
Relevance: 3.702505
  • ratnaprakashfacilityservices.com
  • 3
  • 2
Ratna Prakash Facility Services is one of the Reputed Facility Services Firm in Mumbai. We are the active suppliers of Corporate Facility in Mumbai since the year 2020. Our firm offers the supreme housekeeping and sanitation services to prime hotels,..
Relevance: 3.701399
  • www.cdf.com.mt
  • 1
  • 1
CDF Company Services Ltd has been active as a Company Service Provider since the early 2000's with professional, highly qualified and experienced staff coming from similar backgrounds when such services were still budding in the financial market. CDF..
Relevance: 3.7013307
  • www.omniguardianship.com
  • 1
  • 1
Since 1996, OmniGuardianship Services has been providing high quality, professional services to a wide variety of people in various counties across Central and Eastern Washington... OmniGuardianship Services brings the experience of guardians and..
Relevance: 3.700672
  • www.abeamhealthservices.com
  • 1
  • 1
Abeam Health Services was created from a need that was seen in the community. Abeam Health Services aims to reduce disparities that contribute to mental health care and address culturally specific barriers to services delivery like poverty, language,..
Relevance: 3.700383
  • www.janaktransportservice.com
Our director of the firm, "Mr. janak raj Sharma", holds immense experience in this industry. Under the able guidance of him, we have been able to carve a favorable niche for ourselves in the market.Started in 1985 as a firm with sole proprietorship,..
Relevance: 3.7000477
  • primelineshipping.com
  • 1
  • 1
Primeline Shipping was established in 2016 and we have agents in all major countries, we provide international Freight Forwarding services both Airfreight and Sea freight, Consolidation and Customs clearance. We have many years of experience and are..
Relevance: 3.6998773
  • jumboservices.in
  • 1
  • 2
Jumbo Services is oriented to be the leading and certified company in the provision of technical services in terms of maintenance and repair of home appliances like: RO- Water purifier, Washing machine, Refrigerator, Air conditioner, Water heater. We..
Relevance: 3.699343
  • www.industryanalysis.org
The Professional, Scientific, and Technical Services sector comprises establishments that specialize in performing professional, scientific, and technical activities for others. These activities require a high degree of expertise and training. The..
Relevance: 3.6992803
  • www.nzfsg.co.nz
  • 1
  • 1
NZ Financial Services Group was formed in 2013 when two of New Zealand's leading financial services groups, Allied Kiwi and Loan Market, merged to create one of the largest financial services companies in the country... With more than 20 years in..
Relevance: 3.6987054
  • adamscare.ae
  • 1
  • 2
Adams Care Technical Services was established in 2012 by a group of professionals who have been engaged in the UAE's HVAC, Cleaning, And Maintenance Industry for more than 20 years. Following our successful local reach, we expanded our line of..
Relevance: 3.6980443