Companies similar to PAUL RIGBY
Sign up to Download

2971-3000 of 6,701,384 results

  • www.krpm.co.uk
  • 1
  • 3
KRPM is a family owned accountancy and business advisory practice. Established in 2011 to deliver a service clients deserve. We believe in fair pricing for the work we do. We come to you, we pick up and drop off your records and we are available..
Relevance: 14.667452
  • www.impossibleinvestors.com
  • 1
  • 1
Witness for yourself how I'Mpossible Investors are able to achieve 99% win rate when we invest in the market... *By registering, you agree that I'Mpossible Investors may collect, use and disclose your personal data, which you have provided in this..
Relevance: 14.667422
  • 1000homechallenge.com
Learn about the projects and find resources on case studies, webinar presentations, data and more... Learn all about the steps to register your project and join the 1000 Home Challenge... Transforming America with deep energy reductions, reducing..
Relevance: 14.666735
  • 1000homechallenge.com
Learn about the projects and find resources on case studies, webinar presentations, data and more... Learn all about the steps to register your project and join the 1000 Home Challenge... Transforming America with deep energy reductions, reducing..
Relevance: 14.666735
  • www.evanalysiscorp.com
  • 1
  • 1
  • 5
EV Analysis Corporation essentially strives to help you get more insight out of big data using the latest proven techniques... We are working on our latest demo on image clustering. This program classifies text based on how you want it to be..
Relevance: 14.665677
  • qlift.com.au
  • 1
  • 1
Here at QLift Australia, your safety and that of your employees and customers is of the highest priority. We will ensure all required Safety Standards are met and we will exceed those standards by ensuring you are aware of any concerns surrounding..
Relevance: 14.665582
  • www.maurentia.com
  • 5
We provide statistical and data science consulting services to clients in academia, government and business. We help derive solutions from your data so that you can create solutions for our world... Maurentia Analytics offers fully-personalized data..
Relevance: 14.664912
  • www.appliancerepairtechs-dallastx.com
  • 1
Committed to covering all service needs without delays, our company dispatches Dallas appliance repair pro techs quickly. You get the service you want when you need it the most and without spending an arm and a leg or worrying about its quality. At..
Relevance: 14.662772
  • www.primeinntech.com
  • 1
At PIT, the security and privacy of your data are paramount. We implement robust security protocols and best practices, including access controls, data encryption when needed and regular security audits, to safeguard your information. Additionally,..
Relevance: 14.661487
  • bruhnfamily.com
It is our pride to present to you our official website the HID STORES. This is the place where you can find, high quality contents that you can rely on. This is the work of the agents here in HID STORES ensuring that you can believe in the products..
Relevance: 14.661465
  • www.hupropertygroup.com.au
  • 1
  • 1
We are not just about property management or sales; we are about creating lasting relationships. Our approach is always personal, ensuring you know that you are more than just a number to us. You are a part of the H & U family, and your satisfaction..
Relevance: 14.661409
  • www.lab-data.com
  • 3
  • 4
  • 4
LDC is an environmental chemistry QA/QC consulting firm offering an array of services to the Environmental Industry including third party data validation and data usability assessments, custom software products, data management services, specialized..
Relevance: 14.661012
  • www.graphpolaris.com
  • 1
GraphPolaris has many usecases, from fraud detection to supply chain exploration. GraphPolaris is neither use case, domain, nor vendor-agnostic and we are here to help you with your data analysis problem... How can we help? GraphPolaris is neither..
Relevance: 14.660624
  • www.tgprllc.com
  • 1
TGPR is a full-service content marketing and PR agency. Our clients are early stage enterprise cloud companies that want to raise awareness for their people, products and services, but don't want to break the bank doing so. TGPR was founded in 2002..
Relevance: 14.660236
  • www.nevestadispatch.com
  • 1
  • 1
We are a U.S.. based dispatch and full back office support company. We are committed to helping Owner Operators and small to large size fleets establish and maintain business relationships with nothing but the BEST Shippers and brokers. Here at..
Relevance: 14.660135
  • www.bornagroup.co.uk
  • 2
Our company is aware that organisations who process personal data of people in the EU need to be compliant with General Data Protection Regulations (GDPR) - hence we are committed to ensuring our business is GDPR-compliant. Data privacy is a human..
Relevance: 14.659609
  • icefoganalytics.com
  • 1
  • 1
Ice Fog Analytics, based in Whitehorse, Yukon, specializes in ensuring our customers make the best use of the data they collect. We have the experience and tools to help your organization improve operations and set you on a course for success... We..
Relevance: 14.659004
  • www.pilates.online
  • 1
We may use cookies and log file information to: (a) monitor the effectiveness of our marketing campaigns; and (b) monitor aggregate metrics such as total number of visitors, and pages viewed, etc... Generally speaking, we receive and store any..
Relevance: 14.65868
  • nashkellermedia.com
  • 2
  • 1
To Nash-Keller Media you are NEVER just "another client" passed to the newest intern. We are here to help you get the rankings you need in the search engines and continue to help you with your overall digital marketing strategy. We will not rip you..
Relevance: 14.658217
  • bluedieseldata.wordpress.com
  • 1
At Blue Diesel we are passionate about the overall mission of data science. We can help your organization form both a strategic and a tactical data strategy. What makes us differ from others is that we strongly believe the tactical is first. Don't..
Relevance: 14.657744
  • www.piicrawler.com
  • 1
Effective data governance is essential for maintaining data quality and ensuring that PII data is used appropriately. Knowing where sensitive data is located helps establish data governance policies, data ownership, and data lifecycle management..
Relevance: 14.657007
  • danmcwhorter.remax.com
  • 2
  • 2
Choosing an expert realtor can make the difference for sellers and buyers alike. They can help you search for the newest listings, evaluate home value, and provide valuable insight for a successful transaction. Learn how to find the right real estate..
Relevance: 14.656948
  • www.answeringservice.com
  • 4
  • 3
Answering Service provide timely services and reliable solutions to every business need. Among our many administrative services, we provide a friendly, professional answering service dedicated to ensuring that all of your phone calls are captured in..
Relevance: 14.656141
  • admiral-studios.com
  • 1
At Admiral Studios, an expert web development company, we embrace the latest and most advanced technologies. Our team ensures that your website stays ahead of the curve, giving you a competitive edge... Security is our priority. We at Admiral..
Relevance: 14.655819
  • workplacefinancialservices.schwab.com
  • 5
  • 5
Woman [off-screen]: Managing stock plans is not only a ton of moving parts, but parts that start moving faster as your company grows and awards evolve. EquiView is designed to make handling it all easier... Retirement is just one aspect of your..
Relevance: 14.655498
  • rankresearch.com
  • 6
  • 1
  • 6
Do you know everything your company knows? Before any large research initiative RRG believes in an in-depth research review of your company's past research, ensuring future work uncovers new insights…... Testing ads and concepts should be done in..
Relevance: 14.655399
  • enduvo.com
  • 3
  • 1
Enduvo is an XR content creation platform for immersive communication and learning. Our no-code platform makes it easy for anyone to create high-quality simulated content, without any technical experience required... Start with what you know - your..
Relevance: 14.654523
  • www.owm2.com
  • 1
  • 1
With over 4 decades of experience, Outaouais Welding & Machining is one of the leading welding companies in Gatineau and... Outaouais Welding & Machining is committed to ensuring that the collection and processing of data carried out by our owm2.com..
Relevance: 14.654268
  • www.westmidlandsinterchange.co.uk
  • 10
  • 10
  • 9
By filling in this online form, you are agreeing that we can hold and process your personal data in relation specifically to the West Midland Interchange project. We will share your personal data with the West Midlands Interchange team for evaluation..
Relevance: 14.653853
  • www.tubbard.com
  • 1
Our passion is building online brands and that starts with your website. From small businesses, to churches, or event websites, we love building them all... This is the place you expect us to talk about our experience and how special we are. We do..
Relevance: 14.653486