Companies similar to REVIVAL HOME HEALTHCARE SERVICES
Sign up to Download

151-180 of 6,821,344 results

  • atlaslogisticshipping.com
  • 1
  • 1
  • 6
We provide logistic services in the nation, whether it is freight transportation, supply chain solutions, warehousing and distribution, customer resource area services, customs, security and insurance, temperature controlled logistics, industry ….....
Relevance: 3.0556114
  • www.falltd.us
  • 1
We provide logistic services in the nation, whether it is freight transportation, supply chain solutions, warehousing and distribution, customer resource area services, customs, security and insurance, temperature controlled logistics, industry ….....
Relevance: 3.0552893
  • www.allindiapackersmovers.in
  • 1
  • 13
All India Packers and Movers - Nagpur is the prominent service provider of packaging and relocation of commercial and household goods from one place to another place with complete safety and reliability. All India Packers and Movers - Nagpur provides..
Relevance: 3.0552578
  • advericos.com
  • 3
The full cycle advertising agency ADVERICOS MEDIA SERVICES LTD provides a wide range of services for the promotion of customer advertisements on the Internet, at the objects of outdoor advertisement, on radio and television. In addition to..
Relevance: 3.0546277
  • futureglobalservices.com
  • 2
  • 3
  • 1
Future Global Services was incorporated in the year 2011 with a Specific Mission to provide high-quality software development services, staffing services, IT services, software testing services and develop dynamic software packages. Future Global..
Relevance: 3.0544374
  • jctransindia.com
  • 8
  • 4
  • 6
We take pride in being regarded as one of the most reliable and affordable logistic and warehousing service providers in the country. As a third party logistic service provider, we excel at a range of logistic services, which includes trucking..
Relevance: 3.0543404
  • www.supremeltd.com
  • 1
  • 1
We take pride in being regarded as one of the most reliable and affordable logistic and warehousing service providers in the country. As a third party logistic service provider, we excel at a range of logistic services, which includes trucking..
Relevance: 3.0543404
  • helistar.com.my
The company was formed in 2009 by a group of aviation professionals with over 90 years of combined experience in the industry, HRSB provides a wide range of helicopter services (click SERVICES to view) such as charter services, aviation management..
Relevance: 3.054159
  • vividemerald.com
  • 1
Vivid Emerald Marketing is a digital marketing agency that offers SEO services, PPC services, social media marketing services, web design services, and a host of other online services... Let's deliver an experience your customers will love. We're..
Relevance: 3.053981
  • www.neda.com
  • 2
  • 1
  • 3
Neda Communications, Inc. is a provider of consulting services, specialized Internet services, and software engineering services to the data communications industry... Software Engineering Services. As needed, our consulting services are backed up..
Relevance: 3.053981
  • sapautomotivecenter.com
  • 1
  • 1
S.A.P. Automotive Group has been providing customers in the Baltimore, MD 21224 area, with high-quality automotive maintenance and repair services since 2000. Our experienced mechanics will get your vehicle up and running again, and we'll keep it in..
Relevance: 3.0536087
  • www.navharshenterprises.co.in
  • 1
  • 2
  • 1
Navharsh Enterprises is one of the tops and well-known organizations providing services of Housekeeping Services, Deep Cleaning Services, Carpet Cleaning Services, Cleaning services, Housekeeping Services, Garden Development and Maintenance, Swimming..
Relevance: 3.0536022
  • www.delhidetectives.com
  • 2
  • 2
  • 2
Delhi (India) Detective & Investigation Agency & Services specialization lies in client's satisfaction. Delhi (India) Detective & Investigation Agency & Services consists of a team of highly Proficiency & Experienced Agents having specialized..
Relevance: 3.053577
  • www.cadventures.co.uk
  • 1
  • 1
Alongside our design services, we also provide a range of large-format printing and plotting services... Our services cover a range of areas, including Mechanical & Engineering, Building & Services drawing, Printing... CADventures offer a range of..
Relevance: 3.0533388
  • www.northwestfamily.net
  • 2
  • 23
Northwest Family Services, Inc. was established as a Youth and Family Services program in Alva, Oklahoma, in 1976 under the sponsorship of a citizen's group interested in meeting the needs of children and families in Northwest Oklahoma. Since its..
Relevance: 3.0533166
  • ratnaprakashfacilityservices.com
  • 3
  • 2
Ratna Prakash Facility Services is one of the Reputed Facility Services Firm in Mumbai. We are the active suppliers of Corporate Facility in Mumbai since the year 2020. Our firm offers the supreme housekeeping and sanitation services to prime hotels,..
Relevance: 3.0532737
  • nspl.services
  • 2
  • 3
NSPL is a leader in Digital Services delivering Systems Integration Services, Consulting, Managed Services, Cloud Operations & Cyber-Security, ITSM Solutions as well as RPA Services... NSPL Services is the specialists for cyber security of the NSPL..
Relevance: 3.053141
  • www.somyatranslators.com
  • 2
  • 5
SOMYA TRANSLATORS is a well established translation company in India offering best quality translation and Localization services interpretation services in Mumbai, India... Based in Mumbai, Maharashtra, India, Somya Translators Pvt. Ltd. is renowned..
Relevance: 3.0527854
  • www.kylemore.co.uk
  • 6
  • 5
Kylemore Services Ltd. is a specialist building services contractor that provides the full spectrum of building services including mechanical, public health installation and electrical services... Our full range of services includes project..
Relevance: 3.052269
  • www.foxhealth.ca
  • 1
  • 1
  • 6
Effective June 8, 2019, the Financial Services Regulatory Authority (FSRA) assumed the regulatory functions of the Financial Services Commission of Ontario (FSCO). Fox Psychological Services is an authorized provider of services under the FSRA...
Relevance: 3.0519447
  • www.carpenterdavies.co.uk
  • 1
  • 1
  • 8
Carpenter Davies Partnership was formed in 2001 by Ian Carpenter and Gerwyn Davies to provide a comprehensive range of consultancy services in the field of mechanical and electrical building services and environmental engineering, We are now one of..
Relevance: 3.051858
  • www.homeofcargo.com
  • 1
  • 3
We provide logistic services in the nation, whether it is freight transportation, supply chain solutions, warehousing and distribution, customer resource area services, customs, security and insurance, temperature controlled logistics, industry ….....
Relevance: 3.051432
  • daylonservicesltd.com
  • 1
  • 1
We offer a complete range of services from general construction and maintenance to specialist skilled services... Dreaming of a kitchen makeover but don't know where to start? Let Daylon Services help with our expert kitchen remodeling and..
Relevance: 3.0513282
  • forefrontservices.rw
  • 1
  • 1
Forefront Services Ltd came into existence in October 2011 with an objective of tapping into the business opportunities in the following areas : Cleaning and gardening services ; catering and canteen services ; construction services ; events..
Relevance: 3.0508406
  • www.completebookkeeping.ca
  • 1
  • 1
Want to reduce the stress that comes when you're faced with making effective business decisions? Complete Bookkeeping Services can help by providing timely and accurate information extracted from your financial records... Our name says it all!..
Relevance: 3.050531
  • ernestservices.co.ke
  • 1
  • 2
Ernest Services Ltd is a logistics service provider in Kenya. We offer a broad portfolio of services including General Supplies, Hospitality Services, Facility Management, Roadways Cargo Services, Air Freight Services, Railways Transportation..
Relevance: 3.0505269
  • www.dhxcourier.us
  • 1
  • 1
We understand the importance of time, which is why our courier services are designed to meet your bespoke needs... We take pride in being regarded as one of the most reliable and affordable logistic and warehousing service providers in the country...
Relevance: 3.0505085
  • www.vishwarealtors.in
  • 1
  • 1
Our company has created a high mark in the domain of construction services for residential, industrial, commercial and Agriculture properties. The range of construction services include road construction services, bridge construction services, shed..
Relevance: 3.050373
  • suryamediaservices.com
  • 1
  • 2
Surya Media Services a professional corporation Specialized in providing comprehensive services for large-scale international exhibitions, meetings and events, connecting with services, bridging the overseas trade and International business. Surya..
Relevance: 3.050101
  • rureadylawncare.com
  • 2
  • 1
Love a past service? Then let's keep it going! Keep track of all the services you have now and in the past. (Past begins the date of account creation)... RU Ready for a Beautiful Lawn? We can help with many of the different services we provide!..
Relevance: 3.049892