Companies similar to RESILIENT TECHNOLOGIES
Sign up to Download

121-150 of 7,008,975 results

  • cjbusinessservices.com
  • 3
  • 1
  • 1
C&J Business Services is located in Houston, Texas and is an expert in all areas of taxes, consulting, and business services... As a tax preparer with years of experience, C&J Business Services founder, Shonkeithia Milo, works to maximize your tax..
Relevance: 3.7132568
  • www.lifechangerhealthservices.com
  • 1
  • 1
Life Changer Health Services (LCHS) is registered in Maryland and licensed by the Department of Home Health quality as a Residential Services Agency. Our Registration number is R4911. LCHS is incorporated as a Limited Liability Company (LLC). Life..
Relevance: 3.7121532
  • www.vinayvaletparking.com
  • 1
  • 2
Vinay Valet Parking is the leading and largest valet parking company in Delhi. The Company has been providing the services for nearly two decades... At 22 years of professional Vinay Valet parking services, we offer convenient and secure Valet..
Relevance: 3.7112992
  • dislaman.com
We provide logistic services in the nation, whether it is freight transportation, supply chain solutions, warehousing and distribution, customer resource area services, customs, security and insurance, temperature controlled logistics, industry ….....
Relevance: 3.7111096
  • www.grandtech.in
  • 5
  • 7
Grandtech is one of the leading institutions of All kinds of Web and digital services .As a market player with name and fame now we are going to enter in diversifies services.Keeping in mind the gap between service and demand in Urban and rural areas..
Relevance: 3.7100341
  • thincsoft.com
  • 2
  • 1
ThincSofts main business pillars are IT Services and Engineering services. IT Services arm of the company creates IT solutions for our clients in Application, Testing and Validations, Maintenance, Infrastructure, Enterprise and Management..
Relevance: 3.7100027
  • gala.com.pa
  • 3
  • 2
  • 57
GALA Trust & Management Services, Inc. provides integrated advice in the areas of estate planning and management, asset protection, and administrative and accounting services. The company's priority is the generation of value added for its clients,..
Relevance: 3.7098727
  • brioservices.net
  • 1
  • 1
BRIO is an integrated manpower and facilities solutions company, providing you with security personnel, facility management staff, janitorial services.... BRIO is one of the pioneers in Facility services and Guarding services since 1979. Now under..
Relevance: 3.7096314
  • www.janaktransportservice.com
Our director of the firm, "Mr. janak raj Sharma", holds immense experience in this industry. Under the able guidance of him, we have been able to carve a favorable niche for ourselves in the market.Started in 1985 as a firm with sole proprietorship,..
Relevance: 3.7091353
  • www.nzfsg.co.nz
  • 1
  • 1
NZ Financial Services Group was formed in 2013 when two of New Zealand's leading financial services groups, Allied Kiwi and Loan Market, merged to create one of the largest financial services companies in the country... With more than 20 years in..
Relevance: 3.7091103
  • www.eurolineinternational.net
  • 2
  • 1
Established in 1993, Euroline International Ltd is a leading international integrated business service provider in Turkey. We specialize in international business promotion services, marketing strategies, representation and consulting services. At..
Relevance: 3.7075245
  • www.uniqueservice.co.in
  • 1
  • 2
We offer international courier services in Mumbai at cheapest rate. Send your courier / parcel abroad - anywhere in the world easily and quickly with the help of Unique Services. Call now!... We at "UNIQUE SERVICES" bring with us 15 years of..
Relevance: 3.707074
  • lehigh-multiservice.com
  • 1
  • 1
At Lehigh Multiservice, we have served the citizens of Allentown and the Lehigh Valley of Pennsylvania since 2005 with a variety of services, such as tax preparation, Immigration services, Notary Services and Translation services. We are experts in..
Relevance: 3.706842
  • dmca.co.za
  • 1
  • 1
DMcA Financial Services is located in beautiful Hillcrest, KwaZulu-Natal, South Africa. Nestled between rolling hills and magnificent scenery, DMcA Financial Services is in the perfect location for creating a relaxing environment to handle your..
Relevance: 3.7064917
  • adamsfs.com.au
  • 2
Adams Facility Services was established in the 1990's to provide cleaning services to business and industry in the South West of WA... Over 20 years of operation we have maintained a portfolio of satisfied customers, exceeding their expectations by..
Relevance: 3.7056136
  • www.monarchsoftel.com
Catering to the requirements offices, industries, educational institutes such as universities, colleges, etc., we, MSTIPL, bring forth a host of IT Services. Right from Computer AMC Services, Data Processing Services, Data Recovery Services, Domain..
Relevance: 3.705025
  • www.bharathcargomovers.com
  • 1
  • 6
Bharath Cargo Movers provides a wide range of transportation services that begin from goods packing services and concludes with unloading at your doorstep. With experienced professionals and first-class relocation arrangements, we ensure ideal..
Relevance: 3.7050176
  • www.familypreservationla.com
  • 1
  • 3
Family Preservation Services is a subsidiary of Pathways and specializes in non-residential, community-based services for adults with severe emotional/ behavioral disorders who are also receiving Medicaid. The goal of FPS is to provide "Human..
Relevance: 3.7041667
  • mohsencargo.com
  • 1
  • 1
  • 6
We provide logistic services in the nation, whether it is freight transportation, supply chain solutions, warehousing and distribution, customer resource area services, customs, security and insurance, temperature controlled logistics, industry ….....
Relevance: 3.703394
  • www.alliedxlogisticsintl.com
  • 2
  • 6
Our warehousing services are known nationwide to be one of the most reliable, safe and affordable, because we take pride in delivering the best of warehousing services, at the most reasonable prices. Our own warehouses, as well as our partner's..
Relevance: 3.703394
  • globalforwarderr.com
  • 1
  • 6
We provide logistic services in the nation, whether it is freight transportation, supply chain solutions, warehousing and distribution, customer resource area services, customs, security and insurance, temperature controlled logistics, industry ….....
Relevance: 3.703394
  • www.hcsoffshore.com
  • 1
  • 2
Hermes Corporate Services ("HCS") is a leading offshore provider of formation services, registered office services, corporate services, compliance solutions services and other services in the British Virgin Islands (BVI) which is regulated by the..
Relevance: 3.7033002
  • saisrinivasahomecare.com
  • 1
Sai Srinivasa home care services in Vijayawada bring the best home care services in vijayawada at your doorsteps for the comfort of patients and their families. Within a short span of time, we have pioneered in bringing personalized and professional..
Relevance: 3.7030373
  • ratnaprakashfacilityservices.com
  • 3
  • 2
Ratna Prakash Facility Services is one of the Reputed Facility Services Firm in Mumbai. We are the active suppliers of Corporate Facility in Mumbai since the year 2020. Our firm offers the supreme housekeeping and sanitation services to prime hotels,..
Relevance: 3.7026272
  • www.cdf.com.mt
  • 1
  • 1
CDF Company Services Ltd has been active as a Company Service Provider since the early 2000's with professional, highly qualified and experienced staff coming from similar backgrounds when such services were still budding in the financial market. CDF..
Relevance: 3.7025867
  • nucoindustrialservices.com.zm
  • 2
  • 2
Nuco Industrial Services - based in Zambia, are suppliers of specialized mining, process industries products and services... Nuco Industrial Services Ltd is the sole provider of the HWM water processor technology in Zambia, taking any water source..
Relevance: 3.7024186
  • primelineshipping.com
  • 1
  • 1
Primeline Shipping was established in 2016 and we have agents in all major countries, we provide international Freight Forwarding services both Airfreight and Sea freight, Consolidation and Customs clearance. We have many years of experience and are..
Relevance: 3.7017827
  • www.c-steinweg.be
The Steinweg Digital Services Terms and Conditions shall apply to any form of digital services employed by C. Steinweg - Handelsveem B.V. in the course of its services such as our mobile application [Steinweg Online], our website..
Relevance: 3.7015913
  • www.receivershipservices.com
  • 3
  • 2
Our office is located in Monrovia, California, in the heart of the San Gabriel Valley of Los Angeles County. We provide services throughout the state of California. Call us today to learn more and discuss your case assignment. 626.930.0083... Since..
Relevance: 3.7013576
  • jumboservices.in
  • 1
  • 2
Jumbo Services is oriented to be the leading and certified company in the provision of technical services in terms of maintenance and repair of home appliances like: RO- Water purifier, Washing machine, Refrigerator, Air conditioner, Water heater. We..
Relevance: 3.7013505