Companies similar to SMITH
Sign up to Download

2971-3000 of 6,669,259 results

  • www.mspraleigh.com
  • 1
  • 2
A North Carolina law firm devoted to achieving exceptional results for its clients, McMillan & Smith draws from over 130 years of experience with the highest ratings for integrity, achievement and reputation...
Relevance: 9.501061
  • www.smithconsultingservices.nz
  • 2
  • 2
Smith Consulting Services is focused on supporting business performance by identifying areas in which efficiencies can be gained. These areas include staffing related (Talent Acquisition/Recruitment/Generalist HR), Process & Procedure (General day-..
Relevance: 9.500401
  • www.eatcaseys.com
  • 1
  • 1
Kenny Smith and his family have helped feed hungry Lea County residents for over four decades - and you might say that gives them something to crow about... Smith earned his restaurant education working his way up the ranks to management at the Red..
Relevance: 9.499405
  • vashl.com
  • 5
  • 7
We are the View Askew Street Hockey League! We are a group of Kevin Smith fans who get together to play street hockey (often for charity) and have a great time...
Relevance: 9.499402
  • catalog.smithpaper.com
  • 4
Our staff is ready to help you in finding the right product or answer any questions you may have. You can call us or come by our store room Monday - Friday 8-4:30. We are located in Eldon MO off Business HWY 54, just look for the big red roof. We..
Relevance: 9.497227
  • ospreyplumbingandheating.co.uk
Osprey Plumbing & Heating Services is an established plumbing and heating company based in Livingston, but covers areas such as Stirling, Falkirk, Glasgow and Edinburgh for all domestic enquiries and the whole of Scotland for commercial plumbing and..
Relevance: 9.496494
  • www.smithsound.ca
  • 1
  • 1
Since 1986, Smith Sound has provided state-of-the-art audio/visual services and technical expertise to the Greater Vancouver area. Music Festivals, Private Functions, Corporate and Government Events are our domain...
Relevance: 9.494241
  • www.stirlingcapital.org
  • 3
  • 1
  • 3
Our mission is to help our clients pursue financial freedom through exceptional service, planning, guidance, and trust... Planning. Guidance. Trust. Honesty. At Stirling Capital, we believe values matter, and we live by ours every day... Things..
Relevance: 9.494183
  • www.mydouglasvilledentist.com
  • 1
  • 2
  • 4
We know how important having a great smile is to looking and feeling good. That's why Dr. J. Keith Smith and the entire team at our Douglasville, Georgia dental practice is committed to providing the highest quality in family and cosmetic..
Relevance: 9.493445
  • www.smiththomasinsurance.com
  • 1
We at Smith & Thomas Insurance are proud to help protect houses of worship across the Sunshine State. As a top insurer of Churches in Florida, we understand the attention to detail required to be good stewards of that which God has entrusted us..
Relevance: 9.492711
  • rzsarchitects.com
  • 1
RICK Z. SMITH & ASSOCIATES ARCHITECTS, INC. is a smaller firm. This is our strength. As the head architect of the firm, Rick Z. Smith is personally involved in every aspect of a project from the commencement of programming analysis to the conclusion..
Relevance: 9.492336
  • www.webbersmith.com
  • 4
  • 5
  • 5
The WEBBER/SMITH Group® branded companies: WEBBER/SMITH Associates, Inc., AE Design, Inc., and EA Design Concepts, Inc., collectively referred to as WEBBER/SMITH, are independent full-service Engineering and Building Design firms providing..
Relevance: 9.491262
  • prestoncord.ca
  • 1
  • 1
Preston Cord Incorporated is a locally owned, family operated business. Established in 1985. Preston Cord has come from humble beginnings originating in a garage, to now residing in the country setting of Stirling, Ontario after 3 expansions.....
Relevance: 9.491127
  • www.owatonnadental.com
  • 2
Owatonna dentist, Smith Dental Care, PA is a local, trusted dental practice offering general and cosmetic dentistry, teeth whitening, implants, veneers other dental care. Call today to make an appointment!... Supporting the local community and..
Relevance: 9.490839
  • www.ernsmith.com.au
  • 1
Ern Smith Building Supplies is located in Hume Canberra, is a well respected Canberra building supplies company which has been supplying building materials to tradesmen, builders and the DIY home handyman of the Canberra and Queanbeyan region since..
Relevance: 9.490839
  • jaysmithassociatesinsurance.com
  • 1
  • 1
Jay Smith and Associates is an independently owned and locally operated agency that has been serving the Oldham County and surrounding areas since 2001. We have multiple highly rated companies that allow us to compare your rates and coverage so we..
Relevance: 9.490408
  • dbkjcoins.com
  • 1
We are coin buyers in Fort Smith, Arkansas, but travel to approximately 35 coin shows each year. We help our customers locate specialized and hard to find rare coins... Additionally, Dale White is a certified general appraiser licensed in Arkansas..
Relevance: 9.490408
  • www.davidsmithlawnservice.com
  • 1
  • 1
Lawn Service, including fertilizer and mowing, is owned by David Smith and is located in Brainerd and serves Brainerd, Baxter, Nisswa, and surrounding areas and provides lawn mowing, landscape maintenance, fertilizing, weed control, and pest control,..
Relevance: 9.489228
  • www.davidwsmithlaw.com
  • 1
The Oklahoma City attorney at David W. Smith II PLLC provides experienced legal help in family law, estate planning, DUI, LGBTQ matters, and more. Free consultations... David W. Smith II offers zealous representation to clients throughout Oklahoma..
Relevance: 9.487962
  • www.jasonrsmithpainting.com
  • 1
  • 2
Jason R Smith began his painting business in 2014 by providing his painting skills to several friends. The business has grown over the years through satisfied customer referrals. We now provide painting, staining & pressure washing services..
Relevance: 9.484302
  • oldsmithfarm.com
  • 1
  • 1
Experience the magic of Old Smith Farm. Our revitalized working farm is located 10 miles from downtown Portland in the heart of Falmouth's Hurricane Valley Farming District. The Barn at Old Smith Farm is home to our seasonal restaurant and has become..
Relevance: 9.483429
  • www.ralphsmithauction.com
  • 2
  • 4
  • 3
Ralph Smith Auction Realty is a LICENSED 01 FEDERAL FIREARMS DEALER (FFL). Consign Your Firearms With A Fully Licensed Federal Firearms Auction Company! Contact: Lana Nevil at 812-457-8801... Ralph Smith Auction Realty LLC is a full service real..
Relevance: 9.483163
  • www.businessforbuilders.com.au
  • 1
Growing your business is all about having a great marketing strategy. We help you make the right connections and market your business effortlessly... Smith & Sons are the largest networked home renovation company in Australia and New Zealand, with..
Relevance: 9.483023
  • www.crockersmith.co.uk
  • 1
  • 1
With extensive experience across the retail / leisure, workplace and domestic sectors, Crocker|Smith will be an invaluable partner in bringing your ambitions to fruition...
Relevance: 9.48249
  • multilogue.com
  • 2
  • 1
  • 1
Multilogue is the sole proprietorship of Jan Smith, an experienced marketing communications professional. Working with a network of skilled service providers - art directors, graphic designers, web developers, photographers, and videographers - we..
Relevance: 9.48019
  • birminghamtrafficticketlawyer.com
  • 1
  • 1
For more than 30 years Reggie Smith has been helping Birmingham motorists keep their driving record clean with no points reported to DMV... Unlike other traffic defense lawyers who chose to focus on several areas of law and are sometimes spread..
Relevance: 9.4787445
  • www.drewaharmonplc.com
  • 1
  • 1
Drew A. Harmon is a licensed attorney who practices law throughout the state of Arkansas. Drew A. Harmon: Attorney At Law was established in 2009 and has provided quality legal service and expert representation for clients in Fort Smith and for those..
Relevance: 9.4787445
  • www.smithfamilygreens.com
  • 1
  • 1
Smith Family Greens is a family owned and operated Vertical Farm that produces baby leaf salad greens. We grow our salad greens in Organic Soil without the use of pesticides. Our plants are only fed Organic nutrients and raised in a protected..
Relevance: 9.47825
  • www.ingridmaysmith.com
Ingrid May Smith is an award winning, successful, financial services world news journalist; editor and senior content strategist. She prioritises data based insights and can demonstrate a career history that spans achievements within a number of high..
Relevance: 9.47825
  • smithmountainboatrentals.com
  • 1
  • 2
Smith Mountain Boat Rentals is commited to our customers. We exclusively offer dockside delivery and pickup of our rentals for your convenience all over the lake. Experienced boaters or newcomers are all welcome! Please call us with any questions!.....
Relevance: 9.47825