More Fields

Filters

Profiles which have:

Recent Changes

Profiles with recent changes to:
Sign up to Download

1-30 of 339 results

  • idealhealthnow.com
  • 1
  • 2
Ideal Health Now is an independently owned and operated clinic/center authorized to promote and sell Ideal Protein® products and the Ideal Protein ® Weight Loss Method. Consult www.idealprotein.com for more information about the Ideal Protein ®..
Relevance: 14.517158
  • www.nlrwc.com
  • 1
  • 4
Your comfort and health are our top priority, and our physicians are sensitive to your needs and work hard to give personalized care to each individual. We offer specialized care to meet a variety of women's health needs through the various stages of..
Relevance: 14.251083
  • hiddenspringfarmknightdale.weebly.com
  • 1
  • 4
​Located in Knightdale, North Carolina, Hidden Spring Farm is a family run boarding facility featuring multiple disciplines and boarders from all walks of life. Hunter/Jumpers, dressage, eventers, and trail riders all enjoy the amenities and low-key..
Relevance: 13.14197
  • www.geowavesolutions.com
  • 2
  • 2
  • 4
We offer numerous vibration consulting services that have proven to be very beneficial to contractors, quarries, municipalities and individual property owners. We understand governmental regulations and liability concerns when it comes to blasting,..
Relevance: 13.081615
  • devfinity.io
  • 5
Devfinity is a global team of experts to solve your technology needs. Leverage technology to grow your business!... Devfinity provides world-class technology solutions for businesses. Whether you are building an app, need a website, or want to keep..
Relevance: 12.286232
  • finmec.com.au
  • 7
  • 2
  • 6
Finmec is a locally owned and operated company based in Port Hedland that provides quality repair, maintenance and equipment hire services for the mining, transport and civil industries in the northwest of Australia. Like many successful companies,..
Relevance: 11.659927
  • www.texasbpwfoundation.org
  • 5
The Texas Business and Professional Women's Foundation, Inc. provides advocacy and support for educational, literary, scientific and charitable activities...
Relevance: 11.575499
  • www.henard.com
  • 11
  • 9
We enjoy our work, even though we have our good days and our bad days. We are proud of what we have accomplished. We have great employees, with very little turn over. We have fun, yet when it comes to our work we are very conscientious, we strive for..
Relevance: 11.152054
  • ansonplacecarecentre.ca
  • 8
  • 1
  • 8
Anson Place Care Centre is comprised of an accredited long term care home with 47 residents. Located in the heart of beautiful Hagersville, our country home opened in 1991 and is fully sprinklered. We take pride in the care we deliver, our home..
Relevance: 10.428005
  • esinc.org
  • 1
  • 2
  • 8
As a non-profit organization Employment Solutions is non-owned and is governed by a Board of Directors. The Board membership represents a variety of community and business interests who are recruited for their particular backgrounds and expertise...
Relevance: 10.165592
  • www.coatssql.com
  • 3
  • 9
COATS is a resource and partner for staffing firms. We understand the unique challenges of the industry and the volume of information you must store, manage and access. Since 1995, we have been improving our software to enable our partners to operate..
Relevance: 9.88394
  • smiththornton.com
  • 8
  • 1
  • 8
Smith Thornton Advisors, LLC is a privately owned wealth management company and SEC Registered Investment Adviser... Smith Thornton Advisors, LLC is a registered investment adviser. Information presented is for educational purposes only and does not..
Relevance: 9.643587
  • www.virago.co.uk
  • 15
  • 3
  • 9
Virago was founded by Carmen Callil in 1973 as a feminist publishing company. Inspired by the political and social change of that decade, the women who created Virago believed passionately that writing by women should be celebrated, enjoyed, taken..
Relevance: 9.625127
  • www.trinityalpscapital.com
  • 2
  • 1
  • 9
Trinity Alps Capital is a boutique institutional investment manager comprised of passionate, dedicated, and innately collaborative professionals with a singular goal to protect and grow clients' capital over the long-term. Offering global private..
Relevance: 9.423255
  • www.n-blaw.com
  • 8
  • 9
  • 8
Niedweske Barber Represents Individuals and Companies In All Aspects of Employment, Commercial and Serious Personal Injury Law... Niedweske Barber specializes in all aspects of employment law, commercial litigation, and serious personal injury law,..
Relevance: 9.418495
  • westerndaycare.ca
  • 2
  • 2
  • 9
Our purpose is to provide quality care and education to children who are between the ages of 3 months and 5 years. Western Day Care Centres are among the largest daycare centres in South Western Ontario with over 30 years …... Our Mission is to..
Relevance: 9.398893
  • www.pediatricclinicknoxville.com
  • 3
  • 7
From sick visits and general check-ups to immunizations and labs, Pediatric Clinic Knoxville prides itself on providing the pediatric care your child needs!... At Pediatric Clinic Knoxville, we want to make your visit as easy as possible. To save..
Relevance: 9.27198
  • newalbanyhealthandrehab.com
  • 1
  • 11
At New Albany Health & Rehab, we are dedicated to providing unmatched quality in skilled nursing, staff support, and community life for our long-term residential and rehabilitation patients. Nestled in a peaceful community in New Albany, MS, New..
Relevance: 9.029488
  • verdenveterinary.com
  • 1
  • 2
  • 10
Our team's expertise is expansive with dedicated leadership in both large and small animals. Our veterinarian in Verden is well known and our level of care extends to our whole team including technicians, vet assistants, and our receptionist. We'd..
Relevance: 8.8074875
  • www.jkenn.com
  • 11
  • 1
  • 10
J. Kennedy and Associates, Inc. ("Kennedy and Associates") is an economic consulting firm specializing in the electric, natural gas, and water utility industries. We provide services in utility rates, resource planning, contract negotiations, and..
Relevance: 8.802142
  • www.worthing-dental.co.uk
  • 2
  • 12
Grand Avenue Dental Practice has been established since 1978, and is situated in a beautiful period building in Worthing. We are easily accessible by public transport and also have car parking available on site... Our main objective is to maintain..
Relevance: 8.643107
  • coastlineinsurance.com
  • 1
  • 12
Coastline Insurance Associates of NC, Inc. was founded on a proven business philosophy that puts the clients' needs first. Our mission is to always be responsive, dependable, and professional... No one can predict the future - that's why we have..
Relevance: 8.591171
  • www.papetroleum.org
  • 5
  • 1
  • 11
We offer several education programs, from NORA Certification Programs and CETP classes, HAZMAT training classes, custom classes for your company, and more. View our education section for a complete list of upcoming classes and to register for a class..
Relevance: 8.434182
  • wvmsfoundation.wordpress.com
  • 1
  • 12
When you think of your children in middle school, what comes to mind? Homework? Extracurricular activities? Of course. These basic tenants are all part of our children's lives in the formative sixth, seventh, and eighth grades. We expect such, but..
Relevance: 8.410477
  • coastlineinsurance.com
  • 1
  • 13
No one can predict the future - that's why we have insurance. As an independent insurance agency, we do the difficult work of finding the best rates for your specific needs. In addition, we are experienced and well versed in the unique challenges of..
Relevance: 8.288438
  • www.okmulgeeonline.com
  • 4
  • 23
  • 13
Access bids and request for proposals for consultants, service providers, contractors, vendors, and suppliers... Civic & Non-Profit Organizations Review a list of civic and non-profit organizations in the Okmulgee area... Create an Account -..
Relevance: 8.267259
  • www.chicagocapital.net
  • 1
  • 2
  • 13
Chicago Capital is a Registered Investment Advisor. Chi-Cap provides financial advosory services... At Chi-Cap, service is at the core of what we do. We put clients first. If we can help, let us know. We're here for you... At Chi-Cap, we take a..
Relevance: 8.1217985
  • www.gateways.com.au
  • 3
  • 6
  • 12
Gateways Support Services is a not-for-profit community organisation making a positive difference in the lives of children and adults with a disability or additional needs and their families for more than 20 years... Gateways is recognised and..
Relevance: 8.101614
  • www.millwoodsfootball.ca
  • 11
  • 43
To provide the best minor football program in Edmonton and improve the quality of community and sporting life for all it's members... Learn and teach the game of football Develop team, social skills and self-esteem Promote fitness and activity..
Relevance: 7.943518
  • www.expresspromotions.com
  • 15
  • 6
  • 14
Express Promotions is committed to excellence and quality for your every need and specification...
Relevance: 7.9424777