Companies similar to SMITH
Sign up to Download

2971-3000 of 6,670,966 results

  • theoldtramhouse.com
  • 1
  • 2
The Old Tram House Traditional Apartments, Stirling, Scotland Self Catering Apartments for short and longer term rental. A real alternative to a hotel stay. Best Price Guaranteed for Direct Bookings. ♦ Before each check-in, a rigorous deep clean is..

Relevance: 9.498719
  • www.vanburenpd.org
  • 1
  • 10
  • 5
Welcome to the Van Buren Police Department Home Page. We are located in Van Buren, AR, Northeast of Fort Smith, AR and on Interstate 40 five miles east of the Oklahoma border...

Relevance: 9.496557
  • www.hartsvillesclaw.com
  • 5
  • 1
  • 4
Smith, Watts and Associates is a full-service law firm located in Hartsville, South Carolina. For more than 35 years attorneys of Smith, Watts and Associates have served our clients by providing the highest quality services in a practical and..

Relevance: 9.495257
  • www.drewsmithpainting.com
Drew Smith Painting has been providing quality painting/staining workmanship to houses, condominiums, places of worship and commercial properties in Western New York since 1986. Our skilled painters are trained in the latest techniques so we can..

Relevance: 9.491679
  • www.arradfootbalconies.com
  • 1
  • 1
Arrad Foot Balconies is proud to work in conjunction with Havwoods International, a renowned leader in the flooring industry, both technologically and aesthetically... Arrad Foot Balconies is made up of a strong team of 7, including 3 managing..

Relevance: 9.491679
  • www.smithconsultingservices.nz
  • 2
  • 2
Smith Consulting Services is focused on supporting business performance by identifying areas in which efficiencies can be gained. These areas include staffing related (Talent Acquisition/Recruitment/Generalist HR), Process & Procedure (General day-..

Relevance: 9.490537
  • www.smithwaters.co.uk
  • 1
  • 1
Smith Waters is a firm of Chartered Surveyors specialising in property management. As members of both ARMA and RICS we are a professional organisation with a high quality portfolio of properties. We operate within a small geographical area,..

Relevance: 9.490462
  • vashl.com
  • 5
  • 7
We are the View Askew Street Hockey League! We are a group of Kevin Smith fans who get together to play street hockey (often for charity) and have a great time...

Relevance: 9.490156
  • michaelsmithdesign.co.uk
  • 1
Michael Smith Design is a creative studio based near Arundel in West Sussex. I work with some of the biggest brands as well as providing graphic design for local business...

Relevance: 9.489446
  • www.contractorsdesign.co.uk
  • 1
  • 1
  • 8
Contractors Design (CDS) Ltd was originally established in January 2000 by Simon Smith, a Chartered Civil & Structural Engineer with extensive experience in the design of both Permanent and Temporary Works...

Relevance: 9.489446
  • www.clementscreate.com
On 4 October 2022, Clements Limited entered Administration, with Dean Anthony Nelson and Nicholas Charles Osborn Lee of PKF Smith Cooper being appointed as Joint Administrators...

Relevance: 9.488808
  • www.crockersmith.co.uk
  • 1
  • 1
With extensive experience across the retail / leisure, workplace and domestic sectors, Crocker|Smith will be an invaluable partner in bringing your ambitions to fruition...

Relevance: 9.486921
  • www.windmillfarmsproduce.com
  • 1
  • 1
In 1974, Windmill Farms, an independently own family business, was founded by Earl Smith, his wife, his parents, and his brother Les Smith and wife... Windmill Farms is an independently owned, family business founded in 1974. From a roadside stand..

Relevance: 9.485648
  • www.smithsound.ca
  • 1
  • 1
Since 1986, Smith Sound has provided state-of-the-art audio/visual services and technical expertise to the Greater Vancouver area. Music Festivals, Private Functions, Corporate and Government Events are our domain...

Relevance: 9.484736
  • ospreyplumbingandheating.co.uk
Osprey Plumbing & Heating Services is an established plumbing and heating company based in Livingston, but covers areas such as Stirling, Falkirk, Glasgow and Edinburgh for all domestic enquiries and the whole of Scotland for commercial plumbing and..

Relevance: 9.483066
  • www.drewaharmonplc.com
  • 1
  • 1
Drew A. Harmon is a licensed attorney who practices law throughout the state of Arkansas. Drew A. Harmon: Attorney At Law was established in 2009 and has provided quality legal service and expert representation for clients in Fort Smith and for those..

Relevance: 9.481108
  • birminghamtrafficticketlawyer.com
  • 1
  • 1
For more than 30 years Reggie Smith has been helping Birmingham motorists keep their driving record clean with no points reported to DMV... Unlike other traffic defense lawyers who chose to focus on several areas of law and are sometimes spread..

Relevance: 9.481108
  • masmithpainting.com
  • 1
  • 1
At M.A. Smith Painting all of our projects matter from small to large. We are happy to complete all interior and exterior projects for both the home owner and the contractor...

Relevance: 9.479371
  • jacksmithagency.com
  • 1
  • 2
The Jack Smith Agency is a independent insurance agency located in Litchfield, Michigan. Started in 1975, agency staff includes principals Brian and Jack Smith, as well as a number of additional support personnel. As Independent Insurance Agents we..

Relevance: 9.476768
  • dowdensmith.com
  • 1
At Dowden & Smith, LLC in Leesville, LA, we believe that every individual deserves skilled legal guidance backed by years of experience and extensive knowledge when dealing with unexpected or difficult legal matters. For 35 years, our attorneys at..

Relevance: 9.476449
  • catalog.smithpaper.com
  • 4
Our staff is ready to help you in finding the right product or answer any questions you may have. You can call us or come by our store room Monday - Friday 8-4:30. We are located in Eldon MO off Business HWY 54, just look for the big red roof. We..

Relevance: 9.473894
  • www.leesmithlawllc.com
  • 1
Nothing is more frustrating than being injured because of someone else's negligence. When you suffer an injury at the hands of another person or organization, our team will work tirelessly to make sure you get the compensation you deserve. We have..

Relevance: 9.473473
  • as-photonics.com
  • 1
  • 1
AS-Photonics is an independent small company providing technical consulting services and modeling software in the areas of crystal nonlinear optics, fiber lasers, and thermal issues. Our mission is realistic, quantitative, numerical modeling of these..

Relevance: 9.473473
  • www.smithsfallsford.com
  • 3
  • 3
  • 5
Our team would like to thank you for visiting us. We carry new and used Ford vehicles as well as other makes and models. We proudly serve the Town of Smiths Falls and the surrounding communities. Our first and foremost goal here at Smiths Falls Ford..

Relevance: 9.473264
  • www.shiraluft.com
  • 1
  • 1
I am a Licensed Clinical Social Worker (LCS #23864) and earned my Masters Degree at Smith College School for Social Work. My Bachelor's Degree is in Psychology with a minor in Education. My professional training also includes the post-graduate..

Relevance: 9.473008
  • www.hydeparkadvisors.com
  • 4
  • 1
  • 5
Hyde Park Wealth Advisors is an independent financial services firm in Cincinnati specializing in wealth creation, wealth management, and preservation strategies... Dempsey Lord Smith, LLC nor Hyde Park Wealth Advisors LLC provides tax or legal..

Relevance: 9.47299
  • planecastle.co.uk
  • 1
  • 2
Stay in a Scottish Castle. Plane Castle is a truly medieval experience and not to be missed for your Scottish Castle holiday... Steeped in history, Plane Castle has character and charm.The castle with its spiral staircases, painted beamed ceilings,..

Relevance: 9.472716
  • www.walkersupholstery.com
  • 1
  • 1
Walkers Upholstery has been established for over 50 years, we are a friendly family business based in Cupar, Fife. We pride ourselves on our reputation for high quality products and a friendly service... Although we are based in Fife we offer..

Relevance: 9.472716
  • www.ralphsmithauction.com
  • 2
  • 4
  • 3
Ralph Smith Auction Realty is a LICENSED 01 FEDERAL FIREARMS DEALER (FFL). Consign Your Firearms With A Fully Licensed Federal Firearms Auction Company! Contact: Lana Nevil at 812-457-8801... Ralph Smith Auction Realty LLC is a full service real..

Relevance: 9.472201
  • www.smithbros-siding.com
  • 1
Smith Bros. is a third generation family business, small enough to know you and large enough to take care of your project. Deal direct with the owners Steve or Rich...

Relevance: 9.472079